PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g41693.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 532aa    MW: 61607.8 Da    PI: 9.4426
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g41693.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR129.82e-09681075190
              FAR1  51 errtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       ++++ ++ r+gCk ++++ ++kd+ w++t++ l+HnH+l+
  Bradi1g41693.1.p  68 NKKNASSIRCGCKTMIRLLRTKDHGWYITDFILHHNHPLS 107
                       57889999******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-669107IPR004330FAR1 DNA binding domain
PfamPF105519.5E-19202290IPR018289MULE transposase domain
PROSITE profilePS509669.322460496IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MPVPGRAGPL ESAHRGFAQR TSENILSVQS GLCFDCLPEA YEYFNLYSWE VGFGIRYKKA  60
NVTNGFPNKK NASSIRCGCK TMIRLLRTKD HGWYITDFIL HHNHPLSRNN GEKLCWSSHK  120
HIDRYTRELV RNLREKDVPL TKVYSILGNY FGSVEDIPNK RSLENLCKQI SKEEANDDKR  180
GSLVLFMNGK SKLDYQYFGD AITFDTTYKT KLYGMPFGLS VGVNNHFQSI IFSGVLMRQE  240
TIESFEWIFR EFTSLVGGKP HVTILTAMEV AIKRVLKSTT HRWCKWHVFK MAKERLGSVY  300
TKNNNFKAEF HKLINCNITV PEFEAAWKEL MEKYDLKEHH FLTSIYESRH RWEKPFFSGI  360
FCAKMTSTQR SESANHMLKG YVPPGASMHL FVKQYNTLIA DLISKEDSEN QRTRMVGVVL  420
KTRWPIEKHA ASIYTSKMLE MFSDHSFDSA AREKWSKVQY EVTISDDRGL YTCECGLAEH  480
MGMLCCHSIQ VMLRLGVDKV PDAHILKRWT KNASDVLPHH LAHLQNTQRF TK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3IRT90.0A0A0Q3IRT9_BRADI; Uncharacterized protein
STRINGSi005043m1e-160(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-67FAR1-related sequence 5